PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa013217
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 219aa    MW: 23965.2 Da    PI: 8.456
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-45875PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.15.5e-1573117347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r    +Rt+ q+ s+ qky
        Lsa013217  73 PWTEEEHKLFLLGLKKYGKGDWRNISRNYVVTRTPTQVASHAQKY 117
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.72766122IPR017930Myb domain
SuperFamilySSF466894.49E-1767121IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-1869121IPR006447Myb domain, plants
SMARTSM007179.3E-1370120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-1270117IPR009057Homeodomain-like
CDDcd001672.74E-1273118No hitNo description
PfamPF002498.6E-1373117IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
XLVPGFGHDG PVAGEDGGGC DXDSIRNCED DVSSIEAGLY PKSPPYGGGG KRSPVDVIAA  60
GRPVEQERKK GVPWTEEEHK LFLLGLKKYG KGDWRNISRN YVVTRTPTQV ASHAQKYFIR  120
QLSGGKDKRR ASIHDITDSE VNENQNSLPK NKRTSPEQCK FQWSHPGGGG GDAAMAFDQT  180
NGSMFMSPRY KGNGGLHEFY GGSQSMVFQM QPAMHYPHG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002314123.15e-75syringolide-induced protein 1-3-1B
SwissprotQ8S9H72e-65DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A118K2211e-102A0A118K221_CYNCS; Homeodomain-like protein
STRINGPOPTR_0009s04730.11e-74(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.15e-37Homeodomain-like transcriptional regulator